HORDB

ID: hor006482
Uniprot ID: Q9GMB7(103-135)
Protein name: Osteostatin
Gene name: PTHLH
Organism: Equus caballus (Horse)
Family: Parathyroid hormone family
Source: animal
Expression: NA
Disease: NA
Comments: NA
Taxonomy: Equus (genus), Equidae (family), Perissodactyla (order), Laurasiatheria (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
GO MF: GO:0005179 hormone activity; GO:0051428 peptide hormone receptor binding
GO BP: GO:0002076 osteoblast development; GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway; GO:0030282 bone mineralization; GO:0032330 regulation of chondrocyte differentiation
GO CC: GO:0005576 extracellular region; GO:0005634 nucleus; GO:0005737 cytoplasm

Sequence: TRSAWLNSEVAESGLDGDHLSDFSTTSPELYLR
Length: 33(103-135)
Propeptide: HQLLHDKGKSIQDLRRRFFLHHLIAEIHTAEIRATSEVSPNSKPAPNTKNHPVRFGSDDEGRYLTQETNKLEPYKEQPLKTPGKKKKGKPGKRKEQEKKKRRTRSAWLNSEVAESGLDGDHLSDFSTTSPELYLRRH
Signal peptide: NA
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Function: Neuroendocrine peptide which is a critical regulator of cellular and organ growth, development, migration, differentiation and survival and of epithelial calcium ion transport. Regulates endochondral bone development and epithelial-mesenchymal interaction
Mechanism: NA
Cross BBB: NA
Target: PTH1R
Target Unid: F6Z5Y6
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor006482_AF2.pdb

hor006482_ESM.pdb

Mass:	422585	Formula:	C158H241N43O57
Absent amino acids:	CIKMQ	Common amino acids:	S
pI:	4.07	Basic residues:	3
Polar residues:	13	Hydrophobic residues:	10
Hydrophobicity:	-56.36	Boman Index:	-7653
Half-Life:	7.2 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	73.94
Instability Index:	6028.48	Extinction Coefficient cystines:	6990
Absorbance 280nm:	218.44